SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POPTR_0007s02840.1|PACid:18243889 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0007s02840.1|PACid:18243889
Domain Number 1 Region: 7-93
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000216
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0007s02840.1|PACid:18243889
Sequence length 112
Sequence
MEIELVNKKLTTTDIKSCLVYPTANLRAFQMVQGENAIRFNARDPTGRVWEFKLCTRNHG
RYKKPVIRGDWLDYVREKGLTVNDSIILTMVADAENGGSYNIRVEPNTELAI
Download sequence
Identical sequences B9HE55
XP_002310473.1.11743 POPTR_0007s02840.1|PACid:18243889 3694.fgenesh4_pg.C_LG_VII000264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]