SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0007s09930.1|PACid:18243367 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0007s09930.1|PACid:18243367
Domain Number 1 Region: 48-170
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.38e-17
Family N-acetyl transferase, NAT 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0007s09930.1|PACid:18243367
Sequence length 407
Sequence
MIVVREFDPRKDGVGVEEVERRCEVGPGGKLSLFTDLLGDPICRVRNSPAFLMLVAEIGE
EIVGMIRGCIKTVTCGKKLSRTVKNNYSYNVINNNDLSKPVPVYTKVAYILGLRVSPSHR
RMGIGLKLVHQMEDWFRQNGAEYSYIATENDNHASVKLFTDKCGYSKFRTPSILVNPVFA
HRVPVSNRVTIIKLTPHDAELLYRRRFATTEFFPRDIDSVLKNKLNVGNFLAVPRGSLKS
GSWAGPDSFLSDPPESWAVLSVWNCKDVFRLEVRGASRVKRTFAKTTRVVDKALPFLRLP
SVPAVFRPFGLYFMYGLGGEGPRAAKMMKALCGHVHNLAKESGCGVVVTEVANREPLKLG
IPHWKMLSCAEDLWCIKRLGEDYSDGSVGDWTKSPPGLSIFVDPREF
Download sequence
Identical sequences U5G4G2
XP_006380626.1.11743 POPTR_0007s09930.1|PACid:18243367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]