SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s03890.1|PACid:18247557 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s03890.1|PACid:18247557
Domain Number 1 Region: 145-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-30
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s03890.1|PACid:18247557
Sequence length 708
Sequence
MFEAKLRDGYTQVLQIPKLHSGPMIREFQVMNPPKEQMRVAEKCLDSQLWHACAGSMVQM
PAVNSKVFYFPQGHAEHAQGSVDFGHFQIPALIPCKVSAIKYMAEPETDEVYAKIRLTPS
SNSDLMFGDGCGEDSDDRLPNGIESQEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPR
LDYTAEPPVQTILAKDVHGETWKFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFLR
AENGDLCVGIRRAKRGIGGGNECSSGWNSFGGYSGFLREDESKLTRRNGNGDMKGKVKPE
SVIEAASLAANGQPFEVVYYPRASTPEFCVRASAVRTAMHIQWCPGIRFKMAFETEDSSR
ISWFMGTISSVQFADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLAELVSNMPAIHLS
PFSPPRKKLRLPQPPDFPLLGQIPMPSFTGIPLRSNSPLCCVSDNIPAGIQGARHAQFEL
SSSDLHFNKLQSGLFPVDFQRRDHAASPSRISSGNFMGNTKKSENISCLLTMGNSSQSLK
ESSETKTPHFVLFGQLIVTDQQSSQSCSGDTNANSSSDGNLGKASSDGSGSALQQNGPME
NSSDERSTWYKDHQKTDLGLETDHCKVFLESEDIGRTLDLSVLGSYEELHRKLASMFGIE
SSEMLSNVLYRDAAGATKHAGDEPFSEFLKTARRLTILSYASRDNFGR
Download sequence
Identical sequences B9HLK7
XP_002311089.2.11743 POPTR_0008s03890.1|PACid:18247557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]