SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s03920.1|PACid:18248998 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s03920.1|PACid:18248998
Domain Number 1 Region: 114-299
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.8e-22
Family N-acetyl transferase, NAT 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s03920.1|PACid:18248998
Sequence length 330
Sequence
MHFVRCVQALLNQNKNQKESPFPYREIEGEGETERQSLQFLPIEMRSIPLGFSVSPTSIN
NHLNFNLKKQKQQRQQQNQYFFTSSSTRVSRHELTLSSLPKSGLCRASQVAEFYPTVSPE
IVVREARLEDCWEVAETHCSSFFPEYSFPLDFVLRVDRLAAMLSGFSIPNGCRRTCLVAV
VGSSVDQTFYIGIENFKIGGFDGKFSLNRGYVTGILTVDTVADFLPRKGPLRQRRTGIAY
ISNVAVRERFRRKGIAKRLIAKAEAQARSWGCRSIALHCDLNNPGATKLYKGQGFKCIKV
PEGASWPQPKTSPDIKFNFMMKLLNTPITT
Download sequence
Identical sequences B9HLL0
POPTR_0008s03920.1|PACid:18248998 XP_002312016.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]