SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0008s15210.1|PACid:18248976 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0008s15210.1|PACid:18248976
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000838
Family N-acetyl transferase, NAT 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0008s15210.1|PACid:18248976
Sequence length 591
Sequence
SNFNRLNFGGFYAVILERGDEIISTASIRFHGTRLAEMPFIGTRHMYRRQGMCRRLFYAI
ESTLCSLKVEKLIIPAISELMHTWTEVFGFTTLDELLKQELKSMNMLVFPGIDMFQKELR
QENIDGKRSTSIGFGANQMEFEEDSECIKTVVNKSDADSPAGHDAHDCDNSGLECSIGKN
EVASASSDSQCADVSSNNVSTMNSSLDVSHGLQSAVPLKEETIQTNSKSEDKLVQSAVDK
KSECVSYTTHDVREMVKSKSDSPVEDTSLTGFKGDVAAMDTDTQLPGASLGDASGMSGSL
DASCELKDAAPFDGTSSADSESEGKILGSASITILNVSGDSQEENKSEMASPAKDSDQSC
KVDGINLFHSLNLNESVSGELKVSKSVEESGCADSQSEETFVEITLKMETMPLSDSSVVN
NNVACNDGDLSDIPTGSVDMVSLEAVPSIEKTTAENFVEKVNEISGVSVSGFSGAEENNM
QIESNPNSEIGHERGIKLDVVPEAVSDAMYCGGAASQGKSNLALSDTNTSTEFLLCVSVL
DFHAELGMLQLVSYLLDDGGESNVGKCSQWWRLVADMWRCSSVDDQRIHAM
Download sequence
Identical sequences B9HJX8
POPTR_0008s15210.1|PACid:18248976 XP_002311624.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]