SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s01700.1|PACid:18227632 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s01700.1|PACid:18227632
Domain Number 1 Region: 145-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-43
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 589-674
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000638
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s01700.1|PACid:18227632
Sequence length 713
Sequence
MEIDLNHPVTEVEKNSFCTNGDSSCSSNSSSSPVSSSIYLELWHACAGPLTSLPKKGNVV
VYFPQGHLEQLASSSPFSHRDMPNFDLHPQIFCKVVNVQLLANRENDEVYTRLTLLPQPE
VVGQDLEGKELQELGVDGEGDDASPTKSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFP
SLDYKQQRPSQELLAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL
RGEGGELRLGIRRAARPRNGLPDSVTGKQNSLPSALSLVSNAISTKSVFTVSYSPRATHA
VFVVPYQKYIKSITNAVCIGTRFKMRFEMDDSPERRCSGVVTGTADLDPYKWPNSKWRCL
MVRWDEDVISDHQERVSPWEIDASVSLPPLIIQSSPRLKKLRTGLQAAPPDKPIAGGGGF
LDFKESVRSSKVLQGQENVGLLSPVYRCQEICSLSSVGALGKPNTGRSSFQMYPGPRPAF
YPVAAESLRSMYFPYGDVYKNGQDPRTQSYAIFSRENAHFNTSSIQTCVVREEVRKPNQS
SEYKTQESISAAPALCANLRNQKDDFFNGNATGCKLFGFSLNAETSPNSQNTSKRSCTKV
HKQGSLVGRAIDLSRLNGYSDLLNELERLFSMEGLLRNPEEGWRILYTDSENDVMVVGDD
PWLEFCNVATKIHIYTQEEVEKMTLFGSSPVIMEASKSSSVGQPDCSPTVIRV
Download sequence
Identical sequences B9HQB3
POPTR_0009s01700.1|PACid:18227632 XP_002313521.1.11743 3694.fgenesh4_pg.C_LG_IX001438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]