SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s02020.1|PACid:18227573 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s02020.1|PACid:18227573
Domain Number 1 Region: 108-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-29
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s02020.1|PACid:18227573
Sequence length 690
Sequence
MKETEKKSLDPQLWQACAGSMVHIPPLNSTVFYFPQGHAEHSQSPVNFPQRIPSLILCRV
ATVKFLADPDTDEVYAKIGFVPLPNTDLDFAHDRGLCGNGNDGDSCPDKPASFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYSSDPPLQTVIAKDVHGEVWKFRHIYRGTPRRHLLTT
GWSTFVNQKKLVAGDSIVFLRAENGDLRVGIRRSKRGIGIGSRPESSLTTGWNSNNATCA
IPYDGFSLFVKEDEMRNGGMKGRGRVKPEEVLEAAGLAANGKPFQVVYYPRSSTPEFCVK
ASSVRAAMRIGWCSGMRFKMAFETEDSSRISWFMGTVTSVQVADPVRWPNSPWRLLQVAW
DEPDLLQNVKRVSPWLVELVSNMPVIHLSPFSPPRKKSRFPQQLGFPLDLQFQLPSFSGN
PLGPSSPLCCLSDNTPAGIQGARHAQFGISLSDIQFNNKQQSGMFLSSLQRFNPHSRNSE
TYLTGHTNSNENISCLLTMGNSNPNLEKSDNVKKHQFLLFGQPILIEQHISHSCSTDAVS
QVINERNSSDESSSKEKISDVLLSAPGKKISQVKSCGTGFSWHQSLHNTSEIGKDTGPCK
VFLESEDVGWTLDLSALCSYEELHGKLANMFGIERSEMSSHVLYRDATGSVKQIGDEPFS
VFMKTAKRLTILMNQPSTESWEVRLRGEKK
Download sequence
Identical sequences B9HQ88
XP_002313508.2.11743 POPTR_0009s02020.1|PACid:18227573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]