SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s10600.1|PACid:18227527 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s10600.1|PACid:18227527
Domain Number 1 Region: 120-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-22
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s10600.1|PACid:18227527
Sequence length 278
Sequence
MAKSKQTYEEIRQKRVEENKKRMEELNLTKLSQSLLSKPSPLKKGKPRTFRPAAALTPVR
RSTRVSDRPTVSYKELPVETLERTRRSYSYRRRGFGVYASSEARAYAIDKAEQIQSRLGA
DFPSFLKPMVQSHVSGCFWLGLPVYFCKSHLPLSDEMMTLEDENGDEFQTKYLAQKTGLS
GGWRGFSIDHELVDGDALVFQLVSPTRFKVYIARAYDSEDNENKEDMEEDNEGKENIDND
KNSDSKHLDGIAKRTRASNCFSTLQNLQKFSMIGNQST
Download sequence
Identical sequences U5G3Z3
XP_006379204.1.11743 POPTR_0009s10600.1|PACid:18227527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]