SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0009s10620.1|PACid:18228161 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0009s10620.1|PACid:18228161
Domain Number 1 Region: 108-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-24
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  POPTR_0009s10620.1|PACid:18228161
Domain Number - Region: 407-471
Classification Level Classification E-value
Superfamily Tropomyosin 0.00414
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0009s10620.1|PACid:18228161
Sequence length 476
Sequence
MDAKEDQNTSPKPQLPISNPVPLNTYPRIRRRKPNMSKIKLTQIHEKSPEPEYKTGHELV
LYDKSGESREPRSRKRKKDAFSVFYDSTETKSPAMELAEEIRTNLEAAYPSFAKTLVRSN
VTVGFWMHLPMRFCKMHLPKNDTTVFLENESGEEYILNYIAERTALSGGWKAFCAANNLH
EGDVLVFHLVKPSRFKVYIVKGNGSSQGDGEFGIPSSGAYGKEIISEPAEKDVKSSKKAE
PLKLLPVGHQEENNQENGLIAVENNKGYVADQSENESEDRASETLRVIKLSGPTVDFNNV
KGIENFRILLNGFAIDSELSEHHRTKYYELCRSQSSFLHSNLLNSINHKLAVEIIIGTVD
ISEGIRSSKLSSSQADYGVWDKTLKGFELLGMKVGFLRERLSRLMSLALESEEAMESECR
EVRLEQARVDEEMKSLELRLLKLKETRERLDDEMEILKENAEKHELTFQEAVNAPW
Download sequence
Identical sequences B9HRZ4
3694.eugene3.00090631 XP_002313110.1.11743 POPTR_0009s10620.1|PACid:18228161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]