SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0011s05380.1|PACid:18231731 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0011s05380.1|PACid:18231731
Domain Number 1 Region: 159-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-20
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0011s05380.1|PACid:18231731
Sequence length 292
Sequence
MLAHYPSTPSSSLTQSNYFAPQYYTTPPCETTQFPSTDSLDQRSQYTPAADPFYPVMVGQ
NAIEMQRSCILQPNALQLEQERRALDAYKTKVARCMRKLARQRRLGRASSGASSTRITDA
SRLALHGAGTDGQNSRTNTSKDLFEFLTPDNKKLRALLRKDLKNSDVGSLGRIVLPKREV
EENLPPLHDKEGILLVLRDIYSNQEWGLKLKFWTNNKSRMYVLENTGEFVKRHGLETGDS
LTLYEDESKNLRSVQDWPVLPSREDNPDEAEAVFLYHKGAETRISPSSNTTP
Download sequence
Identical sequences U5FYF9
POPTR_0011s05380.1|PACid:18231731 XP_006377377.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]