SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0011s14230.1|PACid:18232230 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0011s14230.1|PACid:18232230
Domain Number 1 Region: 219-336
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000392
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0011s14230.1|PACid:18232230
Sequence length 352
Sequence
MLLTRGINHHPYFDDVDEYYLGLSKETEYEKEASNPLEKEFGGPSKLVTGAERYQLLKTL
TSRVFVPKKIRGSGRLGFTSMKTQCPDQKAESTTISIDEFVNPLGTILVPKKRRASRPKL
VRKNNHCIRFDQEDQYLLLRTEIKSSQEKKTAGRKRVLKSQGIDVVDDLRKRSSKKMKKM
GKRVDFKKLGLYPPPDFSSQIKSAISYQEGRDSEIKLRIMKQIFKTDMDKHQERFSMPLN
QIKDGHEFLNKMEMEEVCQSESKSTEVKLVELGLEGGNVHQSTMRLRRWQMNNTVSYVLT
SNWNDVLDRNAGALKVDDIVQVYSFRRDQKLCLVLVKVMDADDQSRQWPREQ
Download sequence
Identical sequences B9I0E7
POPTR_0011s14230.1|PACid:18232230 3694.eugene3.00111148 XP_002317000.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]