SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0012s11900.1|PACid:18229325 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0012s11900.1|PACid:18229325
Domain Number 1 Region: 61-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000479
Family BTB/POZ domain 0.022
Further Details:      
 
Domain Number 2 Region: 271-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000684
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0012s11900.1|PACid:18229325
Sequence length 587
Sequence
MANFSELSSSLSFTSSSHMSNGSISHNISNSSVAEAGTSLEVISLNKLSSSLEQLLIEST
CEYSDADIVVEGIAVGVHRCILASRSKFFHELFRREKGSLEKDGKPKYCMSELLPYGNVG
YEAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDSCRPAITFAVELTYASSIFQVPELVS
LFQRRLLNFVRKALAEDVIPILVVAFHCQSSQLIAQCVDRIAVSNLDNISIEKELPHEVA
DKIKQLRRKPISDDENNTEAGDPLREKRIKRIHMALDSDDVELVKLLLTESDISLDDANA
LHYCASYCDLKVMSEVLSLGLANVNLRNSRGYTVLHIAAMRKEPSVIVSLLAKGASALDL
TSDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRRNPRGGSASITSHTM
VDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTSEFAGLAASKGSSGNLREVDLN
ETPIMQNKRLRSRMEALMKTVEMGRRYFPNCSEVLDKFMEDDLPDLFFLEKGTPDEQRIK
RTRFMELKEDVQKAFNKDKAVINRSVLSSSSSSSSQKDGVGNKLRKL
Download sequence
Identical sequences U5FXX3
POPTR_0012s11900.1|PACid:18229325 XP_006376994.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]