SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s03120.1|PACid:18223081 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s03120.1|PACid:18223081
Domain Number 1 Region: 121-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-21
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s03120.1|PACid:18223081
Sequence length 227
Sequence
MAAKVTAYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPLKRSKPRVVEKQVVV
VRRSNRIANKPAPFFKEAVIDRVVIPRRISKAADLSNLVFATDEARAKAIEKAEKLQSDL
GSDYPTFIKSMLQSHVTGGFWLGCLPLDFCRRNLPRRGDFITLIDEDADEYQVTYLARQN
GLSGGWKGFAVAHGLLDGDAVVFQLIKPTTCKVYIIRVNGSEQGNSL
Download sequence
Identical sequences U5FTX0
XP_006374960.1.11743 POPTR_0014s03120.1|PACid:18223081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]