SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s03130.1|PACid:18222484 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s03130.1|PACid:18222484
Domain Number 1 Region: 106-199
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-21
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s03130.1|PACid:18222484
Sequence length 205
Sequence
MVAKISAYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPMKRSKPRVVEKQVVV
VRRSSRCDTVLLRISKARDLSNRVYATDEARAKAMEKAEKLQSDLGSDYPIFIKSMLQSH
VTGGFWLGLPVDFCRRNLPRRDDVITLIDEEADEYQVIYLARKNGLSGGWKGFAVAHGLL
DGDAVVFQLIKPTACKVVVNMHQCY
Download sequence
Identical sequences U5FNK9
XP_006374961.1.11743 POPTR_0014s03130.1|PACid:18222484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]