SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s09560.1|PACid:18224220 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s09560.1|PACid:18224220
Domain Number 1 Region: 106-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 568-650
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000556
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s09560.1|PACid:18224220
Sequence length 689
Sequence
MAHAERGDDLYSELWKACAGPLVDVPKAGERVFYFPQGHMEQLEASTNQELNQQIPRFNL
PPKILCRVVNIQLLAEQDTDEVYAQITLHPEVDQTRPTSPDPCPPEPAKQTVHSFCKILT
ASDTSTHGGFSVLRKHATECLPPLDMSQATPTQELAARDLHGYEWRFKHIFRGQPRRHLL
TTGWSTFVTSKRLVAGDSFVFLRGDNGELRVGLRRVARQQCSIPSSVISSQSMHLGVLAT
ASHAVLTHTLFVVYYKPRTNQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDTPERRFTGT
IVGVGDISPEWSGSIWRSLKIQWDEPATIQRPERVSPWDIEPFAAPASPNLTQQVVKSKR
PRSVDIPTSEITTNPAASAFWYHGPTQSRELVQRGSITEVQSSESHVWSMRQKEIDSNLN
NNGSCNSRARPEGIWPSSSHMNVSLNFFPDSAADNKCAKTQSIISGFASSISRQSNGLIN
EQVERGRKFENSVGCRLFGIDLTSNSGIAAVPEKEPAYPIVDYNGTQGLVPASSEAEKAQ
TMDVSMSSKEQKQVVPDTLAKESQSKQGSTTSTRTRTKVQMQGVAVGRALDLTVLKGYKD
LINELEKMFETGGELSTREKWAVVFTDNEGDMMLVGDDPWPEFCKMVKKIFIYSSEEVKK
MSTRCKLPASSFEGEGTVVSMESEHKSDA
Download sequence
Identical sequences U5FSL2
XP_006375372.1.11743 POPTR_0014s09560.1|PACid:18224220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]