SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s09560.2|PACid:18224222 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s09560.2|PACid:18224222
Domain Number 1 Region: 107-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 551-633
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000536
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s09560.2|PACid:18224222
Sequence length 672
Sequence
MAHAERAGDDLYSELWKACAGPLVDVPKAGERVFYFPQGHMEQLEASTNQELNQQIPRFN
LPPKILCRVVNIQLLAEQDTDEVYAQITLHPEVDQTRPTSPDPCPPEPAKQTVHSFCKIL
TASDTSTHGGFSVLRKHATECLPPLDMSQATPTQELAARDLHGYEWRFKHIFRGQPRRHL
LTTGWSTFVTSKRLVAGDSFVFLRGDNGELRVGLRRVARQQCSIPSSVISSQSMHLGVLA
TASHAVLTHTLFVVYYKPRTNQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDTPERRFTG
TIVGVGDISPEWSGSIWRSLKIQWDEPATIQRPERVSPWDIEPFAAPASPNLTQQVVKTA
SAFWYHGPTQSRELVQRGSITEVQSSESHVWSMRQKEIDSNLNNNGSCNSRARPEGIWPS
SSHMNVSLNFFPDSAADNKCAKTQSIISGFASSISRQSNGLINEQVERGRKFENSVGCRL
FGIDLTSNSGIAAVPEKEPAYPIVDYNGTQGLVPASSEAEKAQTMDVSMSSKEQKQVVPD
TLAKESQSKQGSTTSTRTRTKVQMQGVAVGRALDLTVLKGYKDLINELEKMFETGGELST
REKWAVVFTDNEGDMMLVGDDPWPEFCKMVKKIFIYSSEEVKKMSTRCKLPASSFEGEGT
VVSMESEHKSDA
Download sequence
Identical sequences U5FV32
XP_006375370.1.11743 POPTR_0014s09560.2|PACid:18224222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]