SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s12980.1|PACid:18222451 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s12980.1|PACid:18222451
Domain Number 1 Region: 147-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.19e-34
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 629-702
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000569
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s12980.1|PACid:18222451
Sequence length 724
Sequence
MGKKRSVAGEAKTSRSHEVGVLKTTKCFNNGLPPRNPQENKDDLYTELWHACAGPLVYVP
RAGDKVFYFPQGHMEQVAARMNEEGKMEMPIYDLPYKILCKVVHVELKAEAGTDEVFARI
TLLPVAEEDELSSNKDGKSLPLHRKTCARSFTKKLTPSDTKTHGGFSVPKRHADQCLPPL
DKSQQPPVQELLAKDLHGFEWCFKHIYRGQPKRHLITSGWSTFVSSKRLVAGDSFIFLRG
ESGELRVGVRRAMKLENNLSANILSSHSMQLGILSSASHAITTGSMFTIYFHPWTSPAEF
IIPYDQYMKSAEIDYSAGTRFRMLFEGEECAEQRFEGTVVGTEDVDHIRWPNSEWRILKV
KWDAASEPFVHQERVSPWNIEPIEPIRKKHASRLHLHKMECIADKSLPRFLISVKEGLLH
GSDEHANESLLEVLQGQEDRDTSANQFGAFKPPPVPHLTSPPNPDWNRSPIGRDNQLQFW
MGGPIYPCPSNTVSFPGGNIARLGIPNSRHSTFNSYGVHDNAVGSRSLSVPNVSHNSGSQ
KWRGSELKHANEVPLAAPHRYMLFGVNLVSNSPELPSSQVATSVVNESHNYVPVTSQSSV
SEPSKSTSGVNSEKQCKNCCSAAIRSCTKVLKYGTVPGRSVDLTQFDGYNELICELDLMF
DFQGSLIDETSGWYVVYSDNEGDMMQIKDCPWQEFQLTVRRIFISPKEDIGKLNPLSPNP
SPSG
Download sequence
Identical sequences B9I9X2
XP_002320368.2.11743 POPTR_0014s12980.1|PACid:18222451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]