SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0015s15800.1|PACid:18233653 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0015s15800.1|PACid:18233653
Domain Number 1 Region: 256-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.51e-16
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 61-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000785
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0015s15800.1|PACid:18233653
Sequence length 587
Sequence
MANFSEPSSSLSYTSSSHLSNGSISHNISNSSGAEAGTSLEVISLNKLSSNLEQLLIDST
CDYSDADIVVEGTAIGVHRCILGARSKFFHELFRREKGSSEKEGKPKYCMSDLLPCGKVG
YEAFLIFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAINFAVELMYASSIFQVPELVS
LFQRRLQNFVGKALVEDMIPILVVAFHCQLSQLVTQCVDRIARSDLDNISIEKELPHDVA
VEIKLLRRKSISDEENNTEAVDALREKRIKRIHMALDSDDVELVKLLLTESDITLDDANA
LHYAASYCDLKVVSEVLSLGLADVNLRNSRGYTVLHIAAMRKEPSVIVSMLAKGASALDL
TSDGQSAVSICRRLTRPKDYHAKTEQGQEANKDRLCIDILEREMRRNPMAGSASITSHTM
VDDLHMKLLYLENRVAFARLFFPTEAKLAMDIAHAATTPEFAGLAASKGSNGNLREVDLN
ETPIMQNKRLRSRMEALMKTVEMGRRYFPSCSEVLDKFMEDDLPDLFYLEKGTPDEQRIK
RTRFMELKEDVHRAFTKDKAEINRTGLSSSSSSSSLKDGISNKLRKL
Download sequence
Identical sequences B9ICJ6
XP_002322351.2.11743 POPTR_0015s15800.1|PACid:18233653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]