SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s09150.1|PACid:18249918 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s09150.1|PACid:18249918
Domain Number 1 Region: 118-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.11e-30
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  POPTR_0016s09150.1|PACid:18249918
Domain Number - Region: 622-672
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0951
Family PB1 domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s09150.1|PACid:18249918
Sequence length 700
Sequence
MITFMEAKEILKEEADKCLDSQLWHACAGGMVQMPAVNSKVFYFPQGHAEHACEPVDFRN
LPGASHTLCRVSAIKFMADPETDEVFAKIRLVPINSNEIDLDDQEVAVNGEKEAAHDNKK
PVSFAKTLTQSDANNGGGFSVPRYCAEMIFPRLDYTADPPVQTLLAKDVHGETWKFRHIY
RGTPRRHLLTTGWSPFVNHKKLVAGDSVVFLRAENGDLCVGVRRAKRAISGGPESLWNPA
LGNLVVPYGGFGAFSREDEHKMVKNGRGNGNGSKSNESLMGRGKVRAESVIQAAVLAANG
LPFETVYYPRANTPEFFVKASLVKTVMQIRWCSGMRFKMAFETEDSSRISWFMGTVCSVQ
DADPLCWPGSPWRLLQVTWDEPDLLQNVKRVSPWLVELASHMSAIHLSPFSSPRKKLRLP
QHPDFPIDGQFPMPIFSGNLLQPSSPFGFLPNNIPAGMQGARHAHYGLPLSDLNLNKLHT
GLLRAGFPPLLDHTASLTKASNIQTIQKPILSEGVSCELTMSHSTQTSKRADDVKIPQLV
LFGQRIVAEQYISRSCSDNTGSPVLARNSCFEGKLDKMAKFSEGSVSTLPHRGLSKHSSC
EGLQWNKNNHRKSEQSLEIGHCKVFLESEDVGRTLDLQLLESYEELYRKLADMFGLRNSE
KFSNLLYRDDNGITKHIGEEPFSNFSKTARRLTIVTRFRQ
Download sequence
Identical sequences B9IFN4
3694.estExt_fgenesh4_pm.C_LG_XVI0323 XP_002323468.1.11743 POPTR_0016s09150.1|PACid:18249918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]