SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0016s14350.1|PACid:18250056 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0016s14350.1|PACid:18250056
Domain Number 1 Region: 324-427
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0016s14350.1|PACid:18250056
Sequence length 917
Sequence
MASSSIKSCMNATCGVSTSSSGGWRKGWALRSGDFAILCDNCGSAYEQSVFCEVFHSKDS
GWRECTSCGKRLHCGCIASKSLLELLDGGGVNCTSCSKSAGVSSVNGDEKTNGFGMSKVD
DAGELQSASADNQLTTETKLMQLGNCIDRIATRNLLQLQSSETDGSYRKMKQEDIIPPVG
EIASTSFLNFNHISNASSQTAKPEIHKTTAAKDLYESLAQTNLSISLGSSLGNPNPFPGG
VVDERVLAKASSPLQQGPRSRHLLPKPPKPALVLDANAGMVSQIRVARPPAEGRGRNQLL
PRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPE
GLPLRIQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMKLQAGDTVTFSRMDPEGKL
VMGFRKASNSIAMQDTQPSAIPNGVPSSESYFSGVFENLPIISGYSGLLHSLKGSTDTHL
SALSKHLHSASGDISWHKSEKQEARTRDGLLLPSLLAPERKRLRNIGSKSKRLLIDSLDA
LELKVTWEEAQDLLRPEPSIKPSIVTIEDHDFEEYEEPPVFGKTSIFVVRSIGGQEQWAQ
CDSCSKWRRLPIDVLLPPKWTCVDNAWDQSRCSCSAPDELAPRELENLLRLTKDFKKRRI
TSSHRPAQEHESSGLDALANAAILGDAGEQSTTAVAATTKHPRHRPGCSCIVCIQPPSGK
GKHKPTCTCNVCMTVKRRFKTLMMRKKKRQSEREAEIAQRIQHMSGPKDEADVESSSKLA
STPMDPSDNEARSGNELESKSQTNNLSNKLADSGKGHLDLNCHPGREEDSQAGLARMSMT
SLLQVASLPLETYLKQNGLVSLSEQQASSASHVPPQAGENGGRIDGDCQPASVAQEQESG
GEEDDEPGPDQSQTDLL
Download sequence
Identical sequences B9IGT0
XP_002323669.1.11743 POPTR_0016s14350.1|PACid:18250056 3694.eugene3.00161312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]