SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0017s01870.1|PACid:18210635 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0017s01870.1|PACid:18210635
Domain Number 1 Region: 114-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.54e-49
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 703-784
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000201
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0017s01870.1|PACid:18210635
Sequence length 813
Sequence
MKLSTSGLGGQQAGQEGEKKCLNSELWHACAGPLVSLPTMGSRVVYFPQGHSEQVAATTN
KEVDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPQEQKETFLPLDLGM
PSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDVEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSCFTVFYNPRWASPSEFVIPLSKYVKAVFHIRVSVGMR
FRMLFETEESSVRRYMGTITGTSDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIE
PLTSFPMYPSLFPLRLKRPWHPGSSSLLDEASNGLIWLRGGSGEQGLPSLNFQANMLPWM
QQRLDPTMLGNDHNQQYQAMLAAGMQNLGGGDPLRQQFMQLQQPFQYPQQSSSPNPLLQL
QQQHQAMLQSIPHNILQPQNQISSDSLPRHLLQQQLNNQPDDQAQQHQHAYHDGLHIQTD
LLQRQQSNLPSPSFSKTEYMDSSPKFTVSTTPMQNILGSLCTEGSGNLLDFTRAGQSTLT
EQLPQQSWVPKYAHHDVNAFSNSLSLPRTYPEKDLSVEAENCNSDAQNPTFFGLLLPTTV
PRYPTSTVDTDVSSMPLGDSGFQNSLYGCVQDSSELLPNAGQMDPPTPSRTFVKVYKSGS
VGRSLDISRFSSYHELREELAQMFGIEGKLENPHRSGWQLVFVDRENDVLLLGDDPWELF
VNNVWYIKILSPEDVLKMGEQGFESSGPNAVKG
Download sequence
Identical sequences U5FJ27
POPTR_0017s01870.1|PACid:18210635 XP_006372462.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]