SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s07420.1|PACid:18214546 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s07420.1|PACid:18214546
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-44
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 942-1009
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000265
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s07420.1|PACid:18214546
Sequence length 1047
Sequence
MKVPSNGFLPNSAEGERKSINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDFVPSYPNLTSKLICMLHNVTLHADVETDEVYAQMTLQPVSKYDKEALLASDLGQKQSR
QPTEFFCKTLTASDTSTHGGFFVPRRAAEKIFPPLDFSMQPPAQELVARDLHDNTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRIFTGDSVLFIRDEKSQLLLGIRHANRQQPALSSSLIS
SDSMHIGILAAAAHAAANNSPFTIFYNPSASPSEFVIPFSKYNKAMYTQGSLGMRFRMMF
TTEESGVRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTASERPNRVSIWEIEPVVTP
FYICPPPFFRPKFPKQPGMPNDESDTENAFKRAVPWLGDEFGKKDAASSIFPGLSLVQWM
SMQQNNQFQAAQSGFFPPMVPSNDLQKNLSTDDPSKLLNFQAPGLSAPSIQFNKTNSENQ
VGQLRRPPMAWTQQQQLQQLLQTSINQQQPPYPQQPQPQLQHVVSPNQIPNQNFQKPFVY
SQQQQQQQQQLLASNIQSQSIPSPNRSSYQLTSLPQDSQFHQQMEQQSNFSHRQQTQLQQ
SPLLLLQQNPSQRVQPQPHQQIQQLSQPDNSEQQLHLQLLQNLQQQQQQQLLSPESLLLQ
SQKLQQQQQTHQQNQQLHQSPLTQNQQPLGSNSFPTAAALMRTQSFPMNQLQGMQNATMA
VRYHSSITDGEAPSCSTSPSTNNWQISPLNFLNRNQQAPAMLMGDSAIEPASNLVQELQS
KSEIHIKNEFPSLKGLDQLKYKGTVTDQLEASSSGTSYCLDAGTIQQNFSAPTFGLDGDV
QSHPASNIDALAPDTLLSREYDSQKDLQNLLVNYGGTAQDINMELSTAAISAQSFGVSNI
PFKPDGSNDIAINDTGILNNGAWTNQNQRMRTYTKVQKRGSVGRSIDITCYKGYDELRHD
LARMFGIEGQLEDPQSSDWKLVYVDRENDILLVGDDPWEEFMSCVQSIKILSSAEVQQMS
LDGDLGNVPAPNQACSGTDSGNVWRGQ
Download sequence
Identical sequences B9INC7
3694.fgenesh4_pg.C_LG_XVIII000045 POPTR_0018s07420.1|PACid:18214546 XP_002324725.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]