SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s11780.1|PACid:18214875 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s11780.1|PACid:18214875
Domain Number 1 Region: 167-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.89e-28
Family B3 DNA binding domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 45-102
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000647
Family GCC-box binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 476-542
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.00000000000256
Family Mammalian PLC 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s11780.1|PACid:18214875
Sequence length 549
Sequence
MEDETVSLISNGETSVVEEFSDSNSSTHPFPASKRARSGSNISASKFKGVVPLPNGHWGC
QIYANHQRIWLGTFKSEKEAAMAYDSAAIKLRSGDSRRNFPLTDVTVEEPKFQSYFSTEV
VLNMIKDGTYQCKFANFTRTCSQSVETELSLKLMMPQSNQGLTCKQLFQKELTPSDVGKL
NRIVIPKKYAIKYFPHISESAEEVDGVMLAFYDKSMKLWKFRYCYWKSSQSYVFTRGWNR
FVKEKKLKANDTISFSLCERGETVDSAAQTFNMIDVNNRENSSSISELSSQSIASKVELQ
LNPGPLIARDSTVKKKERMRGANKRTQNAEKYDNNHLHQELQNQFYLKEQFPNSNDSHEE
EEEEQEEDGKGGISRVKRMIKRVRIFMRTISEKVGDGLDKKNERSNGNVNNDKRLSHQYH
VRPEAKDRASYMNIGTYKFGANCKFNHPIRRKNQAQLLLLPPPPPLLLLELLFGFVFSRH
SLINPVDLLVCLRAIKNSAFQASEYPVVITLVRPPTANLQAKVAEMVTKTVGGMLYCPKI
DQLQEFRYH
Download sequence
Identical sequences B9IMF3
XP_002325139.2.11743 POPTR_0018s11780.1|PACid:18214875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]