SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0018s14300.1|PACid:18214714 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0018s14300.1|PACid:18214714
Domain Number 1 Region: 119-259
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1014-1079
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000853
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0018s14300.1|PACid:18214714
Sequence length 1113
Sequence
MKSPANGAAAAVTNGEGVEKKSINPELWQACAGPLVNLPAAGTHVVYFPQGHSEQVAASL
KKDVNAQIPNYPNLPSKLLCLLHNVTLHADPETDEVYVQMTLQPVSSFDKDALLRSDLAL
KSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKTFPPLDFSMQPPAQELVARDLHDNVW
TFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFMRDEKQQLLLGIRRANRQPTNLSS
SVLSSDSMHIGILAAAAHAAANNSPFTVYYNPRASPSEFVIPLAKYYKAVYSNQISLGMR
FRMMFETEESGTRRHMGTITGISDLDAVRWKNSQWRNLQVGWDESTAGERRNRVSIWEIE
PVTAPFFICPPPFFRSKHPRQPGMPDDDSTDFDSLFKRTMPWLGDDIYMKDPQVLPGLSL
AQRMNMQQNPSLANSMQPNYMQSLSGSVLQNLPGGDLSRQLGLSSPQMPQPNNLQFNAQR
LPQQAQQLDQLPKLQSLLNPLGSIIQSQQQMGDITQQSRQNMMAQTLPSSQVQAQLLQPQ
TLAQTNNILQQQPSIQSHQLLRNLPQTLHQQQQNQQQHIMGQNQQQSLMQSQLSDQVNQH
MQMSDNQIQSQLMQKLQQQQQSVSAQQSAMHQAGQLGQLQDSQRQLLDASQSFSRSMTPS
QMLEIPQTTPTSLPQPNTIPQQMTKNNNQTNTRFSHLPQQLKPQQQHSGIMLLSEMAGHM
GLPPSSMANQLSTAGSSILTAAAGPGQSGITDDVPSCSTSPSTNNCPNIVQPMINGWAHR
STAMGEDMAQSAVTLFSPSALETVSSNGNLVKDLLQKSEVKPSLNISKNQNPGLFSSQTY
LNGVAAQIDYLDTSSSTTSVCLSQNDVHLQQNNNSLSYNPQSVLLRDASHDGELQGDPRN
NILYGTNIDSQLVMPINSDHLLTKGMMGLGKDFSNNFSSGGMLTNCENSKDPQQELSSAI
VSKSFGVPDMPFNSIDSTINDSSLLNRGSWAPPQQQFQRMRTYTKVYKRGAVGRSIDITR
YSGYDELKQDLARRFGIEGQLEDQQRIGWKLVYTDHENDVLLVGDDPWEEFVNCVRCIKI
LSPQEVQQMSLDGDFGNSVLPNQAGSSSDNVNA
Download sequence
Identical sequences B9N847
XP_006372205.1.11743 POPTR_0018s14300.1|PACid:18214714 3694.estExt_fgenesh4_pg.C_1640064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]