SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0019s06060.1|PACid:18218747 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0019s06060.1|PACid:18218747
Domain Number 1 Region: 22-49,80-113,145-623
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.85e-93
Family Acetyl-CoA synthetase-like 0.0000104
Further Details:      
 
Domain Number 2 Region: 835-1195
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-34
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Domain Number 3 Region: 640-702
Classification Level Classification E-value
Superfamily ACP-like 0.000000072
Family Peptidyl carrier domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0019s06060.1|PACid:18218747
Sequence length 1202
Sequence
MRRCSGSSKSQEKQLQHHHKHKHKHCCLSHLFLKAAAQNPPKVAVIYAAPSSSSSSSPAA
ASSGPQTQISRELITSTTPPIYEGDQCFTFANVFSSVDSLSSRLRSILDGADDPHLIKPQ
SPPGKGSNNPGKNQAETASAYNPKIVGIYMPPSVEYIISVFSILRCGEAFLPIDPSWPRD
RVLSIVASANAALIITSRSSFGKGGNKDINEADWLVDRSGCRVLCFSMEDSECSGGPSEL
AWPCENEKERLFCYLMYTSGSTGKPKGVCGTEQGLLNRFWWMQELYPLHGEEALLFKTSI
SFIDHLQEFLSAMLTTCTLVIPPFHELKEYPFSLVNVLQAYSINRLTAVPSLMRAILPVL
QRQHSMQIQTSLKLLVLSGEVFSLSLWDALSTLLPRTTILNLYGTTEVSGDCTYFDCKRL
PAILETEALTSIPIGLPISNCDVALICESDTSNEGEIYVGGLCVSNGYYSESTVTSFISA
NPHMDNICNSSVDNWGCQAYYRTGDFAQRLQNGDLVFLGRTDRTVKINGQRIVLEEIENT
LRGHPDVADAAVISREGPGELLFLDAILLFKEREKSEDFFVRSSIRKWMVDKVPLAMVPN
RFVITESLPMSSTGKVDYALLARSKFLNLHVQDEIGNATSDLLQIIKKAFCDGLMVEEVS
CDDDFFAMGGNSISAAHVSYNLGINMRLLYNFPTPSKLHAALLEKKESYCMEVRVDANSQ
LKPKKDSLVSDMAYSPNPTSPVVPGLKSMKQPSKNPHQNNDDHTVASKRFKEDLDISISS
ACVKPSDGQPLSSSISMLCSFSRCNTVIYDENCRSRKSHQINQLAKVPRNGKGSSMHELW
KVYMESCVDASPLVVVKQQDVYLFIGSHSHKFVCVNALSGSIQWEVKLEGRIESSAAIVG
DFSQVVVGCYSGKIYFLDFLDGSICWTFQTCGEVKCQPVVDIHRQLIWCGSHDHNLYALD
YRNHCCIYKLSCDGSIYGSPAIDEVHNTLYVASTSGHVTAISIKALPFNTLWEHELKVPV
FGSLSLCPSSGNVICCLVDGNIVVLDFCGSIIWRCGTGGPVFAGACISCVLPSQVLICSR
NGRVYSFEMETGDLLWDPITASAYVDEHLQLLSDPCLLSDRLVCVCTSSGRVHLLQINLD
DSGKQNQPGLNIVQEFARLELPGDIFSSPVMIGGRIFVGCRDDYVHCISVEDLSSVYEGA
GY
Download sequence
Identical sequences B9IPY7
XP_002325887.2.11743 POPTR_0019s06060.1|PACid:18218747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]