SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0020s00210.1|PACid:18209101 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0020s00210.1|PACid:18209101
Domain Number 1 Region: 149-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-34
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0020s00210.1|PACid:18209101
Sequence length 609
Sequence
MRKGETGKKRSVAGEAKTSGSHEVGVLETTKWVKNGLPPPPHNPQENKNDLYTELWYACA
GPLVYVPRVGDKVFYFPQGHLEQVAAFLNEDSKTAMPIYDLPYKILCKVVHVQLKAEAKT
DEVFAHITLLPVAEGDELSSNKDGESLLLHRKTRVLSFTKKLTPSDTSTQGGFSVPKRHA
EESLPPLDKSQQPPAQELLAKDLHGSEWRFRHIYRGQPKRHLLTGGWSTFISSKRVVAGD
SFIFLRGESGELRVGVRRAMKLENNLSANVVTAHSMQLGILSSASHAISTGSIFTIFFHP
WTSPAEFIIPFDQYMKSAEIEYSIGTRFIMQFEGEECTEQRIERCEGTVVGAEDVDHIRW
PNSEWRILKVKWDAASDAFVHPERVSPWNIEPIEPIRKKHASLVHQGKKACIADKSLPRF
LISPTIAHLLSPPNPEWNFSPIGKDNQEQFWMHGPVYPCPSSTVSFPGGNIARLGNPNSW
CSTPSSYGVHDNAVGSRSLSVPFVSHNSGSQKWRGFELKHANEVPLAAPHSGGSSYMLFG
VNLENNPPELPSPQVATSVVLENHNYVPLTSQSSVSEPSKSTSGVNSDKQCRNCSSAAIP
SCTKVFYCL
Download sequence
Identical sequences U7E327
XP_006389662.1.11743 POPTR_0020s00210.1|PACid:18209101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]