SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169800273|gb|EDS88885.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169800273|gb|EDS88885.1|
Domain Number 1 Region: 93-156
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000000000000017
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 16-133
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000000085
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169800273|gb|EDS88885.1|
Sequence length 210
Comment 2,3-bisphosphoglycerate-independentphosphoglycerate mutase, putative [Entamoeba histolytica HM-1:IMSS]
Sequence
MEGLKPNTKLQPRQGPVVVCILDGFGIDKEGPGNCVTLANPPYYNKLLAEAKEQHLHTII
KANGPYVGLPTEADMGNSEVGHNALGAGQIYSQGTKLVEESIESGKFFETENWKNVVGAA
VKEGKTVHFIGLLSDGNVHSNTTQLFQMMDGVVKCGGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXQYNTLFKEFRKNSSINHET
Download sequence
Identical sequences B1N573
XP_001914339.1.49425 EnhiA.00400.a 294381.B1N573 jCVI|EHI_112990 gi|169800273|gb|EDS88885.1| gi|183235905|ref|XP_001914339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]