SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121902255|gb|EAY07248.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121902255|gb|EAY07248.1|
Domain Number 1 Region: 280-467
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-32
Family cAMP-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 151-313
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-20
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121902255|gb|EAY07248.1|
Sequence length 566
Comment cation channel family protein [Trichomonas vaginalis G3]
Sequence
MQTLNNNDALSTMVSHYKYATMRYSSNILDKNCRFSHYNRFRRAWEYIMFFLSLMCFAEI
TFVYFIYPQLKFVYYIPFFIPDILFAADHFIIRRTLCISGGEIVDDTEKIKKAYGNFLLI
IHLISIFPLSWIGIIIKYRHVYLILSLNKMLRITRAYTTFMNINNLLPYMGSFATIIPAF
MILLFVTHIFAVIMIIISNAESKPESWTTPYKDRGFTPIMLYITAIYFVLTTVSTVGYGD
ITPETNVEVITIIFVQIIGVIMHTAIIARMISVFVNTLEQSFITQYKVAQDFMKFKKIDN
ERRKEVRNFCQYYWETTGATGGVRNLLRNIPKALRTTIKLEMTRPFFDATVSFNALSPGQ
LAKVAHVIKHITFSPGSYLCKQGEKCNFMLFVGRGIISIIVDDVAIASESCTQSTVHGEN
QMLLGTNCATSIRALTYVDAWVLYQEDLSNLMRHHGYIRNLMMQSIASAYPVMFDDIANH
MLGDIAPKLLLKFRKQNGEVFQNRIPTMRLSESRPRMDMIIQNLSGGETDAGMDSGLRKL
DEKEDEEESSTSSSSSYGNSKVRPFL
Download sequence
Identical sequences A2EJ96
XP_001319471.1.43485 gi|121902255|gb|EAY07248.1| gi|123472556|ref|XP_001319471.1| 5722.A2EJ96 88289.m00141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]