SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121909612|gb|EAY14471.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121909612|gb|EAY14471.1|
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 6.02e-30
Family ADP-ribosylglycohydrolase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121909612|gb|EAY14471.1|
Sequence length 192
Comment ADP-ribosylglycohydrolase, putative [Trichomonas vaginalis G3]
Sequence
MRTTPVGCFCFWDEECVAKAAENLSKVTHYDPKCAYSAVLISLIISRLIKSKSSPNYKFD
LDKTIEDAFTFVEGSNEERDEIMKYLSVKEIEELDLENRDYMGYTLRTTGSAIWALRYTN
SITEAIEKVIREGGDSDTNGAVVGGVLGAKYGFSQLPKDILTYMFNGQWLYNEVDPFMRI
MGIEPPPSFWKK
Download sequence
Identical sequences A2DYT1
gi|121909612|gb|EAY14471.1| gi|123495224|ref|XP_001326694.1| 95068.m00232 XP_001326694.1.43485 5722.A2DYT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]