SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146091019|ref|XP_001466421.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146091019|ref|XP_001466421.1|
Domain Number 1 Region: 793-1057
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000981
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 1060-1313
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000392
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146091019|ref|XP_001466421.1|
Sequence length 2292
Comment hypothetical protein [Leishmania infantum JPCM5]
Sequence
MWGNNFCKAGAHQQSALCCDGQPATMSGSRTSLPSPSYAAQPARPPPAGVLSADLARPIS
VRELAQSRVPAVPPPPPATQAPRPSATTAGFAGFGVPTSSAVYAATSGVSTSRPLSTHAD
AGDLTSLAHRGIDHLSGSELYNYASHLQESSRQYSGYLSAAYAKRDQYRGEVAHLKEELH
NRYVEIDALRREQERASDALLKVREDNAQLRQKLAEAEGHARNMQAKMSVLSGADPSIAV
HFYQSQLALKDAQLRELQQECERAAAASSQRRSSSTTAAEHGRRSANISGEGAAAPHTSP
SRDLPSAEELQDGAEAASAALHTALEELQCLNTSLSHRLEEEHTAHKAALAAHAEASATA
TADRAELLDTIAQLRQQCADMQSAEDELVAALTQRAPISKKDYASLQASYDDLTAALAKA
EAQVAALQEKEQQHHHSAQQAQEELRHSLTTGLEERQSMQARNEQMQSLVNNLERELELA
ERANQLRQEQLDVAISGNQQLAESLHVAQEQLLSATSELQDLRDTRESLESQLRELRQRI
EELEQGEQHQRHRHGGAEAERTLIHTPAASAESEASQQRQESEAELASLRSQRDAVVGDR
DDIIGEVRRLPDERRALLISPPAHAEEQLQSRSSAVRAPLDVRADDREWQKQEDIAALEA
AHQCIEQMKQTIAALQSERVRVEADLKAEVNTLEAELASQSRALAEAEAAAAAQQAHLEE
VMAALRDELVATQAQEKRLRASEEAHRERCAEHQRAVEQLQAHVEELERAARDAASSLPT
PPPAQPSTAAESELRAMNAALDSLAYQLEDAQHRVKELSAEHARTVEELARATRAVAELE
ARAADAEGKHEVMHTAAEVTEAELMARVAALTAENAQLREKLSTSRAAVTTFASRQTDGE
SAAASLEERCAAEARRSEAAEAEASALRETLNGTAAELAEVLQRSEDVQATLERTVARLA
EQESLVGVLSAESTRLQDELATAQRSVLLLTSERDALGEEAAGLRGKISAAEDRASDAAA
AQQRLQACLEEAEAAVRSKDVELSTALAALDRTASEVCDAEQRLQVYSEAKEQLAAEHAR
TVEELARATRAVAELEARAADAEGKHEVMHTAAEVTEAELMARVAALTAENAQLREKLST
SRAAVTTFASRQTDGESAAASLEERCAAEARRSEAAEAEASALRETLNGTAAELAEVLQR
SEDVQATLERTVARLAEQESLVGVLSAESTRLQDELATAQRSVLLLTSERDALGEEAAGL
RGKISAAEDRASDAAAAQQRLQACLEEAEAAVRSKDVELSTALAALDRTASEVCDAEQRL
QVYSEAKEQLAAEHARTVEELARATRAVAELEARAADAEGKHEVMHTAAEVTEAELMARV
AALTAENAQLREKLSTSRAAVTTFASRQTDGESAAASLEERCAAEARRSEAAEAEASALR
ETLNGTAAELAEVLQRSEDVQATLERTVARLAEQEALVEQLNYDASELNDARAVLTDEVT
RLQKALAAAVSDKADVVAQLLATQKELDRAAEAQDAQYRDEERLQDALATTTSAFDVQTT
QVRLGMAHVVDMSRAFCRVAEVAVQRSASQTDGASGTGTSVQEILSPWTRALEWVAAMEQ
RLEALDRGAMPNSFTRTNGRRERRRRRRGRTTESENDDAVEMESNSGSYVLGTSPLCRAV
PANRAEAAFARLIDEQAAATNTIADLRRTLADKEVDLTNLRSAMDALASDLMGERDRADN
LSAAIDDASEKIASAQAEFEEQLRQRTAVTTAEVVEARRAEARATAAQLRAEEQLAAVEK
DLKEQEAVLRKLQDENHRLTREADRLLRTSRLEPSSRARSNVSGSVTPKSLSLSATSAEN
AAQRFTTAPSTLEAIEQAQILQVSSLQADLMLSRRQARELEGREATLRQACAALEQQVSE
LRAKAAEAEHLREDLATLRADYVELEQRYSELELMATAAGGGTMQELKQLRQQLKVREAE
LEEVKARMRDLVLSKAAPELQAARRQEALRESLSGITTQLAATQAQYGGGTGGSSKARSR
RDSLTAALSNSDLNLSSSRPSPQDVLNSRIEHLQTLVHDREVALEKVQAAQLESRAAMDT
LEDQLAAKTAALERAEGLVAEYADTINAFTMAAVARRGNRGAVSTTVPPLSSGMGSPDAE
ALSASVPTLTPLTPRTRAAVNGQPHAAVAMVSPAPRMPNLDEVADDSDGSGEGKQADSAG
PSTDSAPPPVTHRRTSASGSWRGAKSCPAHRPSSSTERSAPSSPSNVPGRKSFAGASVPA
TTRKRARSSTNS
Download sequence
Identical sequences A4I2Y8
XP_001466421.1.40037 psu|LinJ27_V3.1720 gi|146091019|ref|XP_001466421.1| 5671.LinJ27.1480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]