SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146100731|ref|XP_001468931.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146100731|ref|XP_001468931.1|
Domain Number 1 Region: 49-347
Classification Level Classification E-value
Superfamily ApbE-like 2.88e-60
Family ApbE-like 0.00099
Further Details:      
 
Domain Number 2 Region: 384-657,813-894
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.6e-51
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 646-811
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.99e-32
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00025
Further Details:      
 
Domain Number 4 Region: 998-1134
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-28
Family Reductases 0.0027
Further Details:      
 
Domain Number 5 Region: 902-987
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000001
Family Ferredoxin reductase FAD-binding domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146100731|ref|XP_001468931.1|
Sequence length 1147
Comment NADH-dependent fumarate reductase [Leishmania infantum]
Sequence
MADGKTSASVVAVDAESAAKERDAAARAMLQDGGVSPVGKAQLLKKGLVHTVPYTLKVVV
ADPKEMEKAAADAEQVLQAAFQVVDTLLNNFNENSEVSRINRMPVGEEHQMSAALKHVMA
CCQKVYNSSRGAFDPAVGPLVRELREAAHKGKTVPAEHVNDLLSKCTLNASFSIDMNRGM
IARKHADAMLDLGGVNKGYGIDYIVERLNSLGYNDVFFEWGGDVRASGKNQSNQPWAVGI
VRPPALADIRTVVPEDKRSFIRVVRLNNEAIATSGDYENLIEGPGSKVYSSTFDPASKNL
LEPTEADMAQVSVKCYSCMYADALATAALLKNDPAAVRRMLDNWRYVRDTVTDYTTYTRE
GERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAQVILLEKEP
KLGGNSAKATSGINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSD
AVKWLSELGVPLTVLSQLGGASRKRCHRAPDKSDGTPVPVGFTIMKTLENHIVNNLSRHV
TVMTGITVTALESTSRVRPDGVLVKHVTGVRLIQSSGQSMVLNADAVVLATGGFSNDHTP
NSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVTLVDMDKVQLHPTGLLDPKDPSNRT
KYLGPEALRGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNET
AAKLFGKNFLGFYWNRLGLFQKVDSVAGLAKLIGCPEANVMATLKQYEELSSKKLNPCPL
TGKNVFPCVLGTQGPYYVALVTPSIHYTMGGCLISPSAEMQTIDNSGVTPVRRPILGLFG
AGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKSTGLSTTEWSTVVLREVREG
GVYGAGSRVLRFNMPGALQRTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILA
RADKGRLAEWISALQPGDAVEMKACGGLIIERRFADRHFFFRGHKIRKLALIGGGTGVAP
MLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEYGSEKFKCHFVLNNPP
AQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKGLGYNMNLVRTVDET
EPTSAKI
Download sequence
Identical sequences A4IB12
XP_001468931.1.40037 5671.LinJ35.1270 psu|LinJ35_V3.1190 gi|146100731|ref|XP_001468931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]