SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154332185|ref|XP_001561909.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154332185|ref|XP_001561909.1|
Domain Number 1 Region: 8-128
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.27e-25
Family Multidomain sulfurtransferase (rhodanese) 0.000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154332185|ref|XP_001561909.1|
Sequence length 128
Comment mercaptopyruvate sulfurtransferase [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MSAPAAAPKHPGKVFLDPSEVKDHLSEYRIVDCRCSLKIKNHGSIEYAKEHLKGAIRADV
DTNLSKFVPGSTARHPLPPCSEFIDWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSL
GAEAYVIN
Download sequence
Identical sequences psu|LbrM05_V2.0950 gi|154332185|ref|XP_001561909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]