SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154344553|ref|XP_001568218.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154344553|ref|XP_001568218.1|
Domain Number 1 Region: 323-420
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.93e-19
Family Multidomain sulfurtransferase (rhodanese) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154344553|ref|XP_001568218.1|
Sequence length 601
Comment hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
Sequence
MLRTGAATASSAVVSSRDVRQRSQGLPRRQVDMHVREKMKWPIAVLSSVEALALLVQGSF
QRWCNVGSDSTRHGIRRFRLSTSSLHRSHLRCSKACLSTGIKGKTPNTDLQGVSGSATDL
RLSVEEELHHPRENVGAFADSSSFRDGEHPSEGVATGAAPLASSSPVPNEAVASIIAEVK
SNAAIFDVNGDGSGADTAPEWTEPTLADLDRSIPQVDCEFMASLIRSRNLRRGVFLTKKE
VVKQRVEELTKKTTRTVNETVRLPFVGGLGLGWFSKPKGGDVVKGEESGLVATSTEAPVL
ASAAVLKKLSVEEKDLLHSTRPEYDDGFVLLDCRTVNEVTSWGIIEGAKVLPAHELFEAF
HATPEEFMEDYGFAKPRPDDIIICYCQYGPRSLMAAQILSWMGYLKVMHFRDGYYEWGKQ
YNLLLRRWMEHDKESGNELRRLATFRAGLELQREIAPEFNALPMQEARQYLRDTTRSPGT
LIVGEGLRLEAYKLVAKLTEGLAPPSLPGVLDDDSSIALTGSRCTAESKTTQTRRLGEQQ
LTRFLEQTTGLDPKKELSRSALSMNMGEAQAMVLDSLAYGHDLGASPDAKTSPMSPPPRR
N
Download sequence
Identical sequences A4HMD8
psu|LbrM34_V2.1080 gi|154344553|ref|XP_001568218.1| XP_001568218.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]