SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|165898304|gb|EDR25209.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165898304|gb|EDR25209.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.57e-25
Family ADP-ribosylglycohydrolase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165898304|gb|EDR25209.1|
Sequence length 193
Comment hypothetical protein, conserved [Entamoeba dispar SAW760]
Sequence
MRTSVLAIPYFWDEEKVKENSKKIGSTTHADPRCQASVNVIVLILAKLLQGREDIEEIIK
ESIYDSEKMLNEEYKKEFIEYTNAKTLEEIKLNESIGYTFKPVGCAILSLREAFKMKEKG
IDKTIIFEKLIERIAYEGGDADTNGAVVGAVLGTYLKGICMPNDWLDLDNKKWLEERLNR
LLHLYQLEPFHFK
Download sequence
Identical sequences B0EJU1
gi|165898304|gb|EDR25209.1| gi|167388192|ref|XP_001738468.1| XP_001738468.1.18373 jCVI|EDI_098010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]