SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|209557231|gb|EEA07276.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|209557231|gb|EEA07276.1|
Domain Number 1 Region: 9-58,88-165,194-343
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-23
Family Capz alpha-1 subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|209557231|gb|EEA07276.1|
Sequence length 362
Comment hypothetical protein CMU_001470 [Cryptosporidium muris RN66]
Sequence
MNTKDKISNLDLVRNLVENIAPGSAFSVVSHCVDLNANISTAQLESLVQEHIEKYSFLVP
LVNFTTESQGLIWGLVWKDAKFPLTKLVSIPNTSSLLSNYNSISNNLTLPKYIDPTLGIA
FTIQPSVMGVVDIEKFEIKQTSNLAKIRIALDSKFEDPVVWNFINNPGSDNYIPLTGEDY
CKFNVPARRTVVFDSEVLPKISKDNLQSLVIVRSAMNLKLSSLKSGSWHSEWVISFPSDE
SQGLNWIGKIFIHSFCGEQGNSHLVYSRENIYIKLEQNFKKLNFSDEDLKNFVEESVSKI
NEAENNFHISLKLEVNKFRDESLTKLRRIVPVNKVPFDWTKFYTSIKDPLSDVISISTSF
NK
Download sequence
Identical sequences B6AGD5
XP_002141625.1.43237 gb|CMU_001470 gi|209557231|gb|EEA07276.1| gi|209880371|ref|XP_002141625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]