SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|67588493|ref|XP_665357.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67588493|ref|XP_665357.1|
Domain Number 1 Region: 165-278
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.99e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.00015
Further Details:      
 
Domain Number 2 Region: 324-351
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000244
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67588493|ref|XP_665357.1|
Sequence length 472
Comment transcription or splicing factor-like protein [Cryptosporidium hominis TU502]
Sequence
MEADITPIGNSTGGNNIYFKGNNPDQISITEISNDNLSKRESRWSKVSDGSTSRWKSVYE
KEYIPPAYSDFPPGMSNYEIDQFLREQRLDELIYKLQMGEIEYGSPDIREPSPPPIYDKN
GSRINTREVRVRKNMEEELSNLIEYMSKNVEGYVVPKDYKPLKKTKKLIIPLDKYPDYNF
MGLIIGPRGYNHRRLEAESGTQISIRGKGTTKEGKKCDHQTEEELAMPMHIHITAESQYK
LDKAVSMIQPLLDPFHPLHEEYKRDGLQQLAIINGTLNTNLNNSSSLINTFSSGNTAITL
AKGCLHCGSTQHPTYACPDVNSLNSFKRPDIKCSICGDKGHITKDCKQYVPNNNVEEEFK
KMMIELGHEVNYNTETTNNAIEHSSSEYNTSGDYYESLYSNNDGQSYYQNGYDQQNYEYQ
TEMNNDSTNFAYQTYQSSIYDNNIMFNNGSIHNQLNSSNNNDDDDDNMDESD
Download sequence
Identical sequences A0A0S4TEQ5
237895.Q5CEU5 Chro.40142 gi|67588493|ref|XP_665357.1| XP_665357.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]