SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|71650382|ref|XP_813890.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71650382|ref|XP_813890.1|
Domain Number 1 Region: 229-473
Classification Level Classification E-value
Superfamily SPOC domain-like 7.06e-57
Family Ku80 subunit middle domain 0.0035
Further Details:      
 
Domain Number 2 Region: 596-723
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 6.67e-32
Family C-terminal domain of Ku80 0.0016
Further Details:      
 
Domain Number 3 Region: 4-170
Classification Level Classification E-value
Superfamily vWA-like 3.34e-21
Family Ku80 subunit N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71650382|ref|XP_813890.1|
Sequence length 744
Comment KU80 protein [Trypanosoma cruzi strain CL Brener]
Sequence
MTLRSALVFALDLNCPSASLALAAEFCRRSAETTMMFAPHDEMALVLAGTCDPHNPPQNG
QKGGERFKHISVPCALAAPTVEFLEPLAHITPPPPPCERHEVDFLETLFVCDHVLRERTA
NKCYQRVVYLITDAHTDVARKDDMNTLLESFQQHGVSLVVIGIDFTETSVDATDDEERDD
KSLTDLSLKAQNERVLHVMCSLLGEESKVVSLEEALQEVQELRRRKITQRALLRVVLSIG
DVRLATQMFTKTQEERLPTMKRTTANGEEVYMKTIFQDLSEDAAPLRKEDLLKGYHYGRS
LVPCAREDVGAMKIKGPRAMDAVGFVPIQQVPAYVLLGGVKVIMPLADDMVGAKAFRSIV
RAIAADNRAMIVRFVRTRDADPVLGLCVPSTNERRDVLFFSPLPYAEDVRFFEFSDYKGM
WGTSSDDGDDGEEARLLAAIVEDMTVGKSVLRPRETFNPVIQQYYATLRAKLRLFCDGRG
AVGGKGSCGAGELRGEKNGEKNTNGEVLLPLVGAIEATSAAFGVPGNQLESVLSSVREKL
EACARSFVYVSNRENCVAEERQPYRFCSPAASHDVDASDASTRAPSTVATPCIISGASQI
TTVDPVYSFKAIVQAREGVNVRLAMDKLGDIVFKLLRCSLGDAQYAKCTECVLVLRQHCV
REGEAAYFNDFLLKLMLMARELDHESFWKNGIMARGIAPITKRECPNSTMDDEEAAHRFL
TQDRTLPALLLEDPTDEGVLNMIT
Download sequence
Identical sequences Q4DHP5
XP_813890.1.87722 gi|71650382|ref|XP_813890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]