SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976399|ref|NP_577756.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976399|ref|NP_577756.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily LigT-like 4.19e-45
Family 2'-5' RNA ligase LigT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18976399|ref|NP_577756.1|
Sequence length 184
Comment integral membrane transport protein [Pyrococcus furiosus DSM 3638]
Sequence
MRAFIAIDVSESVRDALVRAQDYIGSKEAKIKFVERENFHITLKFLGEITEEQAEEIKKI
LEKIAKKYKKHEVNVRGIGVFPNPNYVRVIWAGVENDEIIKKIAKEIDDELAKLGFKKEG
NFVAHITLGRVKFVKDKLGLAMKLKELANEDFGSFIVEAIELKKSTLTPKGPIYETLARF
ELSE
Download sequence
Identical sequences I6U8X2 Q8U4Q3
186497.PF0027 Pfu-34545-001 ar_001000706.1 gi|397652258|ref|YP_006492839.1| WP_011011139.1.13913 WP_011011139.1.59273 gi|18976399|ref|NP_577756.1| d2fyha1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]