SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976436|ref|NP_577793.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976436|ref|NP_577793.1|
Domain Number 1 Region: 196-363
Classification Level Classification E-value
Superfamily RibA-like 8.11e-60
Family RibA-like 0.00000403
Further Details:      
 
Domain Number 2 Region: 4-188
Classification Level Classification E-value
Superfamily YrdC/RibB 4.12e-50
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.0000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18976436|ref|NP_577793.1|
Sequence length 390
Comment bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein [Pyrococcus furiosus DSM 3638]
Sequence
MRNMNIEEIRNSFLSGRPAVLIDEERENEADLVFPAEIATPKVVNFMLSAKGLLCLALDM
EEGIKRGFFKLPNNGGETNFLIPVDYKDVFTGITAEERALTARKVAEGLGIENFRYPGHL
PLLGGLGLNKRKGHTEASLELVEMAGFKRYALIIEILDDKGYSHNLDYAFHFAKEHDLPL
IRIREIWKEFVRRKQLIHVYSKAKLPTKYGDFEIYSFKNDLDFKDHVALVKKPFKGTPLV
RVHSKCLTGDTLGSLKCDCGSQLENALRTISQEGGVLIYLDQEGRGIGLREKIRAYEFQD
RGLDTVEANKALGFAPDERTYEVAFQILRALGIEKIKLLTNNPSKVKALRELGIEIEDVI
PLPGEINRYNFFYLKTKVEKLGHKIPGVEV
Download sequence
Identical sequences Q8U4L7
gi|18976436|ref|NP_577793.1| 397375 Pfu-69558-001 186497.PF0064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]