SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976465|ref|NP_577822.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976465|ref|NP_577822.1|
Domain Number 1 Region: 59-191,517-584
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.2e-42
Family Intein (protein splicing domain) 0.015
Further Details:      
 
Domain Number 2 Region: 585-742
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.12e-42
Family Extended AAA-ATPase domain 0.000000102
Further Details:      
 
Domain Number 3 Region: 760-849
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.12e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 12-59
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000279
Family Extended AAA-ATPase domain 0.00018
Further Details:      
 
Domain Number 5 Region: 265-349
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000000266
Family Intein endonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18976465|ref|NP_577822.1|
Sequence length 852
Comment replication factor C small subunit [Pyrococcus furiosus DSM 3638]
Sequence
MSEEIREVKVLEKPWVEKYRPQRLDDIVGQEHIVKRLKHYVKTGSMPHLLFAGPPGVGKC
LTGDTKVIANGQLFELGELVEKLSGGRFGPTPVKGLKVLGIDEDGKLREFEVQYVYKDRT
DRLIKIKTQLGRELKVTPYHPLLVNRENGEIKWIKAEELKPGDKLAIPSFLPLITGENPL
AEWLGYFMGSGYAYPSNSVITFTNEDPLIRQRFMELTEKLFPDAKIRERIHADGTPEVYV
VSRKAWSLVNSISLTLIPREGWKGIRSFLRAYSDCNGRIESDAIVLSTDNNDMAQQIAYA
LASFGIIAKMDGEDVIISGSDNIERFLNEIGFSTQSKLKEAQKLIRKTNVRSDGLKINYE
LISYVKDRLRLNVNDKRNLSYRNAKELSWELMKEIYYRLEELERLKKVLSEPILIDWNEV
AKKSDEVIEKAKIRAEKLLEYIKGERKPSFKEYIEIAKVLGINVERTIEAMKIFAKRYSS
YAEIGRKLGTWNFNVKTILESDTVDNVEILEKIRKIELELIEEILSDGKLKEGIAYLIFL
FQNELYWDEITEVKELRGDFIIYDLHVPGYHNFIAGNMPTVVHNTTAALALARELFGENW
RHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQDAQQALRRTME
MFSSNVRFILSCNYSSKIIEPIQSRCAIFRFRPLRDEDIAKRLRYIAENEGLELTEEGLQ
AILYIAEGDMRRAINILQAAAALDKKITDENVFMVASRARPEDIREMMLLALKGNFLKAR
EKLREILLKQGLSGEDVLVQMHKEVFNLPIEEPKKVLLADKIGEYNFRLVEGANEIIQLE
ALLAQFTLIGKK
Download sequence
Identical sequences I6U8Q5 Q8U4J3
186497.PF0093 APC66881.0 Pfu-99866-001 gi|18976465|ref|NP_577822.1| gi|397652193|ref|YP_006492774.1| WP_011011205.1.13913 WP_011011205.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]