SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976554|ref|NP_577911.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976554|ref|NP_577911.1|
Domain Number 1 Region: 665-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.82e-64
Family RecA protein-like (ATPase-domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 875-981
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 1.2e-28
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0031
Further Details:      
 
Domain Number 3 Region: 240-400,599-665
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.31e-27
Family Intein (protein splicing domain) 0.01
Further Details:      
 
Domain Number 4 Region: 468-553
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000312
Family Intein endonuclease 0.019
Further Details:      
 
Domain Number 5 Region: 148-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000197
Family RecA protein-like (ATPase-domain) 0.01
Further Details:      
 
Domain Number 6 Region: 4-71
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000000000011
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|18976554|ref|NP_577911.1|
Domain Number - Region: 386-458
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0132
Family Intein endonuclease 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18976554|ref|NP_577911.1|
Sequence length 1013
Comment V-type ATP synthase subunit A [Pyrococcus furiosus DSM 3638]
Sequence
MPAKGRIIRVTGPLVIADGMKGAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGLK
PGEPVEGTGSSLSVELGPGLLTSIYDGIQRPLEVLREKSGHFIARGISAPALPRDKKWHF
TPKVKVGDKVVGGDIIGEVPETSIIVHKIMVPPGIEGEIVEIADEGEYTIEEVIAKVKTP
SGEIKELKMYQRWPVRVKRPYKEKLPPEVPLVTGQRVIDTFFPQAKGGTAAIPGPFGSGK
CVDGDTLILTKEFGLIKIKDLYEKLDGKGRKTVEGNEEWTELEEPITVYGYKNGKIVEIK
ATHVYKGASSGMIEIKTRTGRKIKVTPIHKLFTGRVTKDGLVLEEVMAMHIKPGDRIAVV
KKIDGGEYVKLDTSSVTKIKVPEVLNEELAEFLGYVIGDGTLKPRTVAIYNNDESLLKRA
NFLAMKLFGVSGKIVQERTVKALLIHSKYLVDFLKKLGIPGNKKARTWKVPKELLLSPPS
VVKAFINAYIACDGYYNKEKGEIEIVTASEEGAYGLTYLLAKLGIYATIRRKTINGREYY
RVVISGKANLEKLGVKREARGYTSIDVVPVDVESIYEALGRPYSELKKEGIEIHNYLSGE
NMSYETFRKFAKVVGLEEIAENHLQHILFDEVVEVNYISEPQEVYDITTETHNFVGGNMP
TLLHNTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPNTGKPLMERTVLIA
NTSNMPVAAREASIYTGITIAEYFRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEG
YPAYLASRLAEFYERAGRVVTLGSDYRVGSVSVIGAVSPPGGDFSEPVVQNTLRVVKVFW
ALDADLARRRHFPAINWLTSYSLYVDAVQDWWHKNVDPEWRRMRDKAMELLQKEAELQEI
VRIVGPDALPERERAILLVARMLREDYLQQDAFDEVDTYCPPQKQVTMMRVLMTFYERTM
DAISRGVPLEEIAKLPVREEIGRMKFEPDIEKIRALIDKTNEQFDELLKKYGA
Download sequence
Identical sequences I6TY35 Q8U4A6
WP_011011295.1.13913 WP_011011295.1.59273 gi|397652105|ref|YP_006492686.1| Pfu-193685-001 186497.PF0182 gi|18976554|ref|NP_577911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]