SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976658|ref|NP_578015.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976658|ref|NP_578015.1|
Domain Number 1 Region: 67-147
Classification Level Classification E-value
Superfamily Homing endonucleases 7.58e-16
Family Group I mobile intron endonuclease 0.059
Further Details:      
 
Domain Number 2 Region: 151-266
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000106
Family Group I mobile intron endonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18976658|ref|NP_578015.1|
Sequence length 272
Comment hypothetical protein PF0286 [Pyrococcus furiosus DSM 3638]
Sequence
MRRISELSLDEVENIKKRISELRDEGLSYSKIAGIIGQEFHVSISKATVIRWCKGTSDPA
NRIKRVNLEPSPQLAYIIGVYFGDGSIDADEKYRYRVRLKVVDKEFAEAFANALKDIGAN
PRIYFEGSTGRWCVEATSKELYMFLSKPKEELLRIAKMFPREFIRGFFDSEGYVFVDPKD
PRMAYISVWNYDRELLEICRRLLLNNFNIHSTIFLKREKNSEVIIRGKVYKYNGDLYELR
IYRRESVKAFGEEIGLTIDRKWRALKSFLLSY
Download sequence
Identical sequences I6UZE8 Q8U412
WP_011011400.1.13913 WP_011011400.1.59273 gi|397650784|ref|YP_006491365.1| Pfu-297234-001 gi|18976658|ref|NP_578015.1| 186497.PF0286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]