SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976812|ref|NP_578169.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976812|ref|NP_578169.1|
Domain Number 1 Region: 755-915,1298-1510,1543-1618
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.96e-132
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00084
Further Details:      
 
Domain Number 2 Region: 430-527
Classification Level Classification E-value
Superfamily Homing endonucleases 5.26e-49
Family Intein endonuclease 0.00000257
Further Details:      
 
Domain Number 3 Region: 302-430,716-756
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.34e-44
Family Intein (protein splicing domain) 0.00000023
Further Details:      
 
Domain Number 4 Region: 637-715
Classification Level Classification E-value
Superfamily YcfA/nrd intein domain 3.92e-43
Family PI-Pfui intein middle domain 0.00000582
Further Details:      
 
Domain Number 5 Region: 914-1071,1231-1296
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.24e-39
Family Intein (protein splicing domain) 0.0048
Further Details:      
 
Domain Number 6 Region: 528-631
Classification Level Classification E-value
Superfamily Homing endonucleases 4.35e-24
Family Intein endonuclease 0.00000622
Further Details:      
 
Domain Number 7 Region: 1136-1246
Classification Level Classification E-value
Superfamily Homing endonucleases 2.55e-20
Family Intein endonuclease 0.032
Further Details:      
 
Domain Number 8 Region: 9-154
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000000000392
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0096
Further Details:      
 
Domain Number 9 Region: 234-302
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.00000732
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0067
Further Details:      
 
Domain Number 10 Region: 1065-1136
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000765
Family Group I mobile intron endonuclease 0.055
Further Details:      
 
Weak hits

Sequence:  gi|18976812|ref|NP_578169.1|
Domain Number - Region: 168-267
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.000314
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|18976812|ref|NP_578169.1|
Sequence length 1740
Comment ribonucleotide-diphosphate reductase subunit alpha [Pyrococcus furiosus DSM 3638]
Sequence
MAVEKVMKRDGRIVPFDESRIRWAVQRAMWEVGIRDEKKLDEVVKSIVQRINELYDGKIP
HIENIQDIVELELMRAGLFEVAKAYILYRKKKAEIREEKKRILNKKELDEIDKRFSINAL
RVLASRYLKKDENGNIVESPRELFERVAILAVIPDLLYDERVFDKNGNYSQDLKRVEYYL
EHFEEFDRKYSIGKYKLNKYHFERMVNLYKELAEQGKMKVSIDEFLAMLEKGEFNEYEKE
INEYFRLMTNQIFMPNTPALINSGRPLGMLSACFVVPIEDDMESIMKAAHDVAMIQKMGG
GCIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPE
SKRVVKGKVNVIWKYELGKDVTKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELK
EGDILIGGMPDGEDYKFIFDYWLAGFIAGDGCFDKYHSHVKGHEYIYDRLRIYDYRIETF
EIINDYLEKTFGRKYSIQKDRNIYYIDIKARNITSHYLKLLEGIDNGIPPQILKEGKNAV
LSFIAGLFDAEGHVSNKPGIELGMVNKRLIEDVTHYLNALGIKARIREKLRKDGIDYVLH
VEEYSSLLRFYELIGKNLQNEEKREKLEKVLSNHKGGNFGLPLNFNAFKEWASEYGVEFK
TNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIEGLEVV
RHITTTNEPRTFYDLTVENYQNYLAGENGMIFVHNTGLNFSKLRPEGDIVGTTTGAASGP
VSFMHLIDAVSDVIKQGGVRRGANMGILEIWHPDIEKFIHAKEKNIGTNVLSNFNISVGI
WEDFWEALKEGKKYPLINPRTGEVVKEVDPKTLFEELAYMAWAKADPGVIFFDVINRRNV
LKKAKGGPIRATNPCVVGDTRILTPEGYLKAEEIFSLAKERGKKEAVAVEGIAEEGEPYA
YSVEILLPGEEKVEYETVHGKVLAVADPVAVPAYVWKVGRKKVARVKTKEGYEITATLDH
KLMTPEGWKEVGKLKEGDKILLPRFEVEEEFGSESIGEDLAFVLGWFIGDGYLNVNDKRA
WFYFNAEKEEEIAVRIRDILVKHFGIKAELHRYGNQIKLGVRGEAYRWLENIVKNNEKRI
PEIVYRLKPREIAAFLRGLFSADGYVDKDMAIRLTSKSRELLREVQDLLLLFGILSKIYE
KPYESEFHYTTKNGEERIYRSKGYYELVITNYSRKLFAEKIGLEGYKMEKLSLKKTKVDQ
PIVTVESVEVLGEEIVYDFTVPNYHMYISNGFMSHNCGEEPLYEYESCNLASINLAKFVK
YDENGKPYFDWDEYAYVIQKVAKYLDNSIDVNKFPLPEIDYNTKLTRRIGVGMMGLADAL
FKLGIPYNSEEGFKFMRKVTEYLTFYAYKYSVEAAKKRGTFPLYDKTEYPEGKLPVEGFY
HPEIWNLPWDKLVEEIKKYGLRNAMVTTCPPTGSVSMIADTSSGIEPVYALVYKKSVTVG
EFYYVDPVFEEELKKRGLYSEELLKKISDNYGSVQGLEEIPEDMQRVFVTALDIHWLDHI
IAQASIQMWLTDSASKTINMINEATVEDVKAAYLIARFLGCKGVTVYRDGSLSVQVYSVE
GEKKKRRFKPKPSEYAKKILLEIVEKEPWIKNFINVDEILNGKKEQLLFSLRPANESKLK
VPGREEEVRPGNIPEEKIRELLGVVYCPVCYEKEGKLVELKMESGCATCPVCGWSKCVIS
Download sequence
Identical sequences E7FHX6 I6TV89
gi|18976812|ref|NP_578169.1| 186497.PF0440 NYSGRC-FDAO-18976812 Pfu-451759-001 WP_011011558.1.13913 WP_011011558.1.59273 gi|397650945|ref|YP_006491526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]