SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976839|ref|NP_578196.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976839|ref|NP_578196.1|
Domain Number 1 Region: 827-1000
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-44
Family ATP-dependent protease Lon (La), catalytic domain 0.0000608
Further Details:      
 
Domain Number 2 Region: 21-93,583-801
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-38
Family Extended AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 3 Region: 204-322,575-605
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000000275
Family Intein (protein splicing domain) 0.035
Further Details:      
 
Domain Number 4 Region: 443-548
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000238
Family Intein endonuclease 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18976839|ref|NP_578196.1|
Sequence length 1028
Comment ATP-dependent protease LA [Pyrococcus furiosus DSM 3638]
Sequence
MEEERLDLGIEFETTEEIPVPERLIDQVIGQDHAVEVIKTAAKQRRHVLLIGEPGTGKSM
LGQAMAELLPTENLEDILVFPNPEDENMPRIKTVPACQGRKIVEEYRKRAREQESIKTYL
LFFVFLVVGMAVLMSKGDPNTLLLGVFVILVALMAVANMRIRTQAMVPKLLVDNCGRKKA
PFVDATGAHAGALLGDVRHDPFQCFSGEEVILIEKDGEKKVFKLREFVDGLLKEASGEGM
DGSIRVVYKDLQGENIKILTKDGLVKLLYVNRREGKQKLRKIVNLEKDYWLALTPEHKVY
TIKGLKEAGEITKDDEIIRVPLTILDGFDVAEKSIREELERLSLLPLNSEDSRLEKIAGI
MGALFGSGGIDENLNTLSFVSSEKKTIEQFVKALSELFGEFDYKIEEKENSIIFRTCDKR
IVTFFATLGAPVGDKSKVKLKLPWWVKLKPSLFLAFMDGLYSSNRNDKEILEITQLTDNV
ETFFEEISWYLSFFGIKAEAEEDEEKDKYRARLTLSSSIDNMLNFIEFIPISFSPAKREK
FFKEIEKYLEYSIPEKTEDLKKRVKRVKKGERRNFLESWEEVEVTYNVTTETGNLLANGL
FVKNSGGLGTPAHERVEPGMIHRAHKGVLFIDEIATLSLKMQQSLLTAMQEKKFPITGQS
ELSSGAMVRTEPVPCDFILVAAGNLDTIDKMHPALRSRIRGYGYEVYMRTTMPDTPENRR
KLVQFVAQEVKKDGRIPHFTRDAVEEIVREAQRRAGRKGHLTLRLRDLGGVVRAAGDIAV
RKGKKYVTREDVLEALKLAKPLEKQLADWYIENKKEYQVIKTSGEEIGRVNGLAVIGEQS
GIVLPIEAMVAPAASKEEGKIIATGKLGEIAKEAVLNVSAIIKRYKGEDISRYDIHVQFL
QTYEGVEGDSASISVATAVISALEEIPVRQDVAMTGSLSVRGEVLPVGGITPKIEAAIEA
GIKTVIIPKANEKDVFLSPDMREKIEIVAVERIDEVLEVALADCEKKKELIEKVRKSLPL
GGIENVNS
Download sequence
Identical sequences I6UNC2 Q8U3J9
WP_011011584.1.13913 WP_011011584.1.59273 gi|397650972|ref|YP_006491553.1| gi|18976839|ref|NP_578196.1| Pfu-481472-001 186497.PF0467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]