SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976854|ref|NP_578211.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976854|ref|NP_578211.1|
Domain Number 1 Region: 9-246
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-61
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 277-385,744-962
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-39
Family Extended AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 3 Region: 362-504,662-728
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.71e-37
Family Intein (protein splicing domain) 0.017
Further Details:      
 
Weak hits

Sequence:  gi|18976854|ref|NP_578211.1|
Domain Number - Region: 504-561
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00153
Family Intein endonuclease 0.041
Further Details:      
 
Domain Number - Region: 1013-1047
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.094
Family C-terminal fragment of elongation factor SelB 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18976854|ref|NP_578211.1|
Sequence length 1049
Comment cell division control protein 21 [Pyrococcus furiosus DSM 3638]
Sequence
MDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEV
IENPEEGISAAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEG
IVTRVGEIKPFVSVAVFVCKDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFV
NFQSFRIQDRPETLKGGEMPRFIDGILLDDIVDVALPGDRVIVTGILRVVLEKREKTPIF
RKILEVNHIEPVSKEIQELEISPEEEQIIKELAKRKDIVDAIVDSIAPAIYGYKEVKKGI
ALALFGGVSRKLPDGTRLRGDIHVLLVGDPGVAKSQILRYVANLAPRAIYTSGKSSSAAG
LCVAPDSLVVVNDKVQEIGKLTEEWGREVGFLEYSSGIFYAPYLGRGISLDLVTGKVKPS
VVSKVWKLKSPEELVTIKTITGKEITVTPETKLLTFNGTLEWKEAGKIKPGDYVLTVKKL
HINGKQETLDEKLAYKRGLSLSDPLEFFSSSERTISAYLKGIFDKVGRLVGDTAVIKVDK
DMAKRLQILLLRLGIVSSVDETGKVIIGREYIQKILGYNVSVVTHEVELFREFIAEISKF
YGTSEEDVYSSLHEKGELDIGTVPVELPEGLREEINRERATYSELVKIAQEIKDEKLYNK
LAWILSEVTEEEAKIKEKVNTLKVILSSDLIPERVESVKIIKSPYPYVYDLTVEGSHSFI
ANGFVVHNTAAAVRDEFTGGWVLEAGALVLADGGYALIDELDKMSDRDRSVIHEALEQQT
ISISKAGITATLNARTTVIAAANPKQGRFNRMKNPFEQIDLPPTLLSRFDLIFVLIDEPD
DKIDSEVARHILRVRRGESEVVAPKIPHEILRKYIAYARKNIHPVISEEAMEEIEKYYVR
MRKSVKKTKGEEEGIPPIPITARQLEALIRLSEAHARMRLSPIVTREDAREAIKLMEYTL
KQIAMDETGQIDVTILELGQSARKLSKIEKILDIIEKLQKTSERGAHVNDILEEAKKAGI
EKQEAREILEKLLEKGQIYMPESGYYKTV
Download sequence
Identical sequences I6UND5 Q8U3I4
gi|18976854|ref|NP_578211.1| gi|397650987|ref|YP_006491568.1| WP_011011599.1.13913 WP_011011599.1.59273 186497.PF0482 PfR219 Pfu-497978-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]