SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18976866|ref|NP_578223.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18976866|ref|NP_578223.1|
Domain Number 1 Region: 1-333
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.16e-81
Family Prokaryotic type I DNA topoisomerase 0.0000386
Further Details:      
 
Domain Number 2 Region: 688-988
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.83e-71
Family Prokaryotic type I DNA topoisomerase 0.00015
Further Details:      
 
Domain Number 3 Region: 315-418,474-490,604-687
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.32e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|18976866|ref|NP_578223.1|
Domain Number - Region: 554-623
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00964
Family Intein endonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18976866|ref|NP_578223.1|
Sequence length 1060
Comment DNA topoisomerase I [Pyrococcus furiosus DSM 3638]
Sequence
MILVIAEKPNVARKIAMALAEVKPIKKTLFGVPYYELIRDGKRLIVASAVGHLYGLAPKN
DFFGYPIFDVEWVPVYIAEKGKEYAKDYIKLLSVLSKRVREFIVACDYDTEGEVIGYTAL
KYACGVDPGVAKRMKFSALTKRDLIKAWYNLEPTINFGMANAGIARHILDWYWGVNLSRA
LTHAIKRASGKWVVLSTGRVQGPTLKFLVDREREIQSFVPQPYWVIKLIFEKNGKKYTAN
YEKDKIWDENEAKRIVLEVKKAPARVTNIEVKQQNRNPPVPFDLGTLQREAYSAFGFSPK
KTLDIAQSLYEKGFCLHPDTLILTSQGVRKIKELSREGEVFALDFNLKLSKAKYRLLERD
ADEQMYKVTLLDGTELYLTADHPVLVYREGNLAFVPADKLRETDHVVLVLNKSARDNYGF
LDLLLEITDSQEDYAILENGETLSLHSLKMLVERGEIKDIAVVGFSHNNFGKVMLRDELW
YLIGYLAGKGGEIKGNGVVISSRTKEIVGLTKSLNIDLIETEEGIVLSNKSFVRLLHLIH
YTPRVPEVYGIINNTEWLKAFLAGYYDATLLEGLTLEALYKIKVYLQLLGIRAKIEDNKL
KVHLEDLQRFRELLGKFSRRKLYVETSQVPVFTDFDERSYDFPRILGGDIYIIGIKSIEK
FHYKGKVYDLVVENYHNFIANGIAVHNCSYPRTESQKLPKNLNYKFIIQNLARIPEYRPY
AHLLLGMPELKPVEGKKEDPAHPAIYPTGEIPRPGDLTKDEALLYDMIVRRFLAVFMEPA
VRETVKVTISAGKHKFFISGGRTVKEGWLRVYGKYVKFDEVTLPTFFIGERIKVLQVKRE
KKKTKPPARYSPAAVIKKMEDLGLGTKATRAQILETLYQRGYIEGKKSIKVTPLGMKVIE
TLEKYVPEIISVELTREFEKKMELIMEGKLTKEEVIEEAKIRLTKILEEFKKKELEIGLE
LAKIVVGEEKPPLIVGKCPKCGGDLIVKYNEKTGKRFVGCSNWPKCNVTYPILQRGEIIP
TNKTCCNGAPVVIIREKDGREWEICLDMNCKEYNTIKKKR
Download sequence
Identical sequences I6UZX2 O73954
WP_011011611.1.13913 WP_011011611.1.59273 gi|18976866|ref|NP_578223.1| gi|397650999|ref|YP_006491580.1| 186497.PF0494 Pfu-513748-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]