SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18977202|ref|NP_578559.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977202|ref|NP_578559.1|
Domain Number 1 Region: 57-120
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000288
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18977202|ref|NP_578559.1|
Sequence length 128
Comment hypothetical protein PF0830 [Pyrococcus furiosus DSM 3638]
Sequence
MIRNVLKLLALLADEIVIVALVIIFLRRVSARLAVIVGGALILFNLFLVKLLWGTLKKKA
EVGAEALIGEKAVVVEDLNPVGLVKVKNELWTAECISGTARRGEKVRIVQVKGAKLLVEK
DDNAGKFL
Download sequence
Identical sequences I6V0S5 Q8U2K4
WP_011011959.1.13913 WP_011011959.1.59273 GO.11170 Pfu-808750-001 186497.PF0830 gi|18977202|ref|NP_578559.1| gi|397651329|ref|YP_006491910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]