SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18977366|ref|NP_578723.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977366|ref|NP_578723.1|
Domain Number 1 Region: 214-463
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.02e-48
Family RecA protein-like (ATPase-domain) 0.00045
Further Details:      
 
Domain Number 2 Region: 469-589,945-986
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.08e-40
Family Intein (protein splicing domain) 0.0044
Further Details:      
 
Domain Number 3 Region: 737-843
Classification Level Classification E-value
Superfamily Homing endonucleases 1.11e-23
Family Intein endonuclease 0.012
Further Details:      
 
Domain Number 4 Region: 651-730
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000107
Family Group I mobile intron endonuclease 0.051
Further Details:      
 
Weak hits

Sequence:  gi|18977366|ref|NP_578723.1|
Domain Number - Region: 132-199,339-378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00204
Family RecA protein-like (ATPase-domain) 0.032
Further Details:      
 
Domain Number - Region: 861-918
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0075
Family Phage repressors 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18977366|ref|NP_578723.1|
Sequence length 1150
Comment type II secretion system protein [Pyrococcus furiosus DSM 3638]
Sequence
MGVYEVRKNMEEDKKKKKSWIDEILSSDNLSLESILKKSEEEKPKKVSVESKSLSLGDIL
SGRVKEEEKKREASPLQSLLGGGPPKLEEILKKEEPKREEKKPKIERGALGLQEILAGTT
PRTTSYAGEVRVLDVYGNIRILKVKGEPVPIYEINMPKLSKEEERLVKMVRDRAIVEIQI
DPESIPNPEERRKVFLREVRRMVKEMAPTLSEGRVELISELIVQNMIGYGKIDPLVRDDN
LEEIMVIGINKPVYVWHRRFNMCKTNIVFTDERELLTIIERIAREVGRRIDQQNPLLDAR
LPDGSRVNATLPPISLDGPTLTIRKFKKDPLTIIDLIRFGTLNSEVAAFLWLLVDGLGVK
PANILVAGGTGSGKTTTLNSLAMFIPPSERVISIEDTAELQLPIEHWVRLETRPPNVEGK
GEITMDDLVKNTLRMRPDRIIVGEVRGPEARTMFTAMNTGHDGALYDFSVIQLSNGRFVL
IGDLVEELFKKYAEKIKTYKDLEYIELNEEDRFEVVSVSPDLKANKHVVSRVWRRKVREG
EKLIRIKTRTGNEIILTRNHPLFAFSNGDVVRKEAEKLKVGDRVAVMMRPPSPPQTKAVV
DPAIYVKISDYYLVPNGKGMIKVPNDGIPPEKAQYLLSVNSYPVKLVREVDEKLSYLAGV
ILGDGYISSNGYYISATFDDEAYMDAFVSVVSDFIPNYVPSIRKNGDYTIVTVGSKIFAE
MLSRIFGIPRGRKSMWDIPDVVLSNDDLMRYFIAGLFDADGYVDENGPSIVLVTKSETVA
RKIWYVLQRLGIISTVSRVKSRGFKEGELFRVIISGVEDLAKFAKFIPLRHSRKRAKLME
ILRTKKPYRGRRTYRVPISSDMIAPLRQMLGLTVAELSKLASYYAGEKVSESLIRHIEKG
RVKEIRRSTLKGIALALQQIAKDVGNEEAWVRAKRLQLIAEGDVYWDEVVSVEEVDPKEL
GIEYVYDLTVEDDHNYVANGILVSNCMGTIHANSARETIIRLESPPMSVPRIMIPALDII
IMQVRYHSRKKGTLRRITEIAEVSGIEGESIQLNFLYKYDPAKDELIRTEVPSRFIQTLS
YHTGLSIEELKWEIEKRRLILDWMIEKGIRRIDEVGYYIKEFYIDEEELLKKIEREAETI
ETSKRAKEFI
Download sequence
Identical sequences Q8U256
gi|18977366|ref|NP_578723.1| Pfu-949263-001 186497.PF0994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]