SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18977403|ref|NP_578760.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977403|ref|NP_578760.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily GlnB-like 4.08e-36
Family Divalent ion tolerance proteins CutA (CutA1) 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18977403|ref|NP_578760.1|
Sequence length 103
Comment divalent cation tolerance protein [Pyrococcus furiosus DSM 3638]
Sequence
MIIIYTTFPTWESAEKVTKALLEERLVACANLREHKAFYWWQGKIEEDNEIGVILKTRED
LWEEVKKRIKELHPYTVPAIIKINVEDVNEEYLKWLLEETKST
Download sequence
Identical sequences Q8U220
WP_011012168.1.13913 WP_011012168.1.59273 186497.PF1031 Pfu-987709-001 gi|18977403|ref|NP_578760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]