SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|18977415|ref|NP_578772.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977415|ref|NP_578772.1|
Domain Number 1 Region: 251-391
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 7.32e-24
Family MJ1460-like 0.0067
Further Details:      
 
Domain Number 2 Region: 4-227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.73e-18
Family RecA protein-like (ATPase-domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18977415|ref|NP_578772.1|
Sequence length 406
Comment hypothetical protein PF1043 [Pyrococcus furiosus DSM 3638]
Sequence
MSIVTSIQALDRILGGGIKENCNIALVGSIDNDYVLLMHQIVNSILSQGKKVLLVEFRED
PNSLLEWLKDYGIDYAQYMERKQLRILDGFTNVYSQTQVSKPDILPNPLDLSITSAIIRD
AVSKEKYDFVVLDDITTLYPLQPDPRGYIRVTIRLVNSLKSRGASVIGGINKDVLPIQDL
TMILIPFEYVVEVMNGIIRVKRSYSPLTTPIEGINYVKSKKGIVDVESAFNNVYQMRDSI
TLKEDGSLMLGNLRVQIIDEFSEASLIKFVYMYLGPEKGKEFLYKWGKFESKELKLPKSS
KEKARQILEDMFTTTKITGGGILNFVSFEDDIIVIEGKNLFPRLKNFPYPAHVNYAGSIA
GIVEKLLGGEWKGDEISCESQGHEKCLFVIRKVSDSKSSEEEKEEK
Download sequence
Identical sequences I6TWR2 Q8U209
WP_011012180.1.13913 WP_011012180.1.59273 Pfu-997394-001 gi|18977415|ref|NP_578772.1| gi|397651550|ref|YP_006492131.1| 186497.PF1043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]